RevereCRE
Sign In
Jack Siragusa
******
@cbre.com

BROKER /

Jack Siragusa

CBRE

First Vice President

Job Functions: Landlord Representation, Tenant Representation

Bio

Jack Siragusa is a First Vice President of the CBRE Retail Advisory Group in Chicago, Illinois and he has been active in retail real estate for the past 11 years. Jack's extensive market knowledge, wide network of relationships and strong work ethic distinguish him in the field. He specializes in tenant representation in the urban and suburban markets of Chicago.

With a specific focus on market roll-outs and strategic growth, Jack is proud to represent a diverse array of tenants in the market including: Blink Fitness, Capital One, Pure Barre, Protein Bar, Hannah's Bretzel, Orange Theory Fitness, Aligned Modern Health, Supercuts, Kolo Topdrawer, Kiddie Academy and Marine Layer to name a few.

Jack also has extensive and successful leasing experience in mixed-use developments, urban high rises and traditional shopping centers. Property owners that Jack has had the privilege to represent include: The Sterling Bay Companies, Inland American Real Estate, Citigroup, General Growth Properties, Harlem Irving Companies, The Daly Group, Lodging Capital Partners and Fortress Investment Group among others. Prior to joining the CBRE Retail Services Group, Jack was a Director with the Cushman & Wakefield and was previously an Associate at Mid-America Real Estate Corporation.

Major Transactions

Capital One - Lincoln Park

Nordstrom Rack - North Michigan Avenue

Citibank - Michigan Avenue, Loop

Timeout Market - Fulton Market

The Swatch Group - North Michigan Avenue

Vans - Gold Coast

Areas of Interest

Deal Type
Acquisition, Development, Ground Lease, Loan Purchase, Opportunity Zone, Partner Buyout, Pre-Development, Recapitalization, Refinance, Rehabilitation
ALAKAZCOFLGAINKSMEMAMNNJNCNDOKPASDTXWYCTMOWVILNMARCADEDCHIIAKYMDMIMSMTNHNYOHORTNUTVAWAWINESCIDNVVTLARI