RevereCRE
Sign In

CAPITAL

Timbercreek Capital

Timbercreek Capital

New York , NY

Founded in 1999

Global perspective, local expertise

 

Founded in 1999, Timbercreek is one of Canada's leading alternative asset class investment managers, focused on providing structured financing solutions to experienced real estate owners and investors across selectively identified urban centres primarily in the United States, Canada and Ireland.

 

Through active and direct investment, we employ a thematic approach to deliver compelling risk-adjusted returns for our investors and partners, leveraging the diversified expertise and relationships of our highly experienced team to invest capital across a wide range of asset classes.

 

Timbercreek's team of 40 investment professionals have extensive domain expertise in these markets and combine an entrepreneurial growth focus with institutional risk management.

 

Since 2007, the Timbercreek team has directly originated, underwritten, funded and serviced over 650 individual loans representing over $11 billion of capital, financed by public and private Timbercreek investment vehicles, as well as many institutional partners.

 

Timbercreek has offices in Toronto, Vancouver, New York and Dublin. We are big believers in having boots on the ground. It allows us to be much more agile and seize global diversification opportunities with knowledge and certainty.

Areas of Interest

Risk Profile
Property Type
Deal Type
ALAKAZCOFLGAINKSMEMAMNNJNCNDOKPASDTXWYCTMOWVILNMARCADEDCHIIAKYMDMIMSMTNHNYOHORTNUTVAWAWINESCIDNVVTLARI